PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G522500.1.p
Common NameSb01g048710, SORBIDRAFT_01g048710
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family bZIP
Protein Properties Length: 432aa    MW: 46260.7 Da    PI: 6.579
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G522500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.44.1e-10276328557
                           CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                           kr +r   NR +A rs +RK  +i+eLe+kv+ L++e ++L  +l  l+  +a
  Sobic.001G522500.1.p 276 KRVKRVLANRQSAARSKERKMRYIAELEQKVQILQTEATTLSAQLTLLQRDSA 328
                           999*****************************************999987766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.8E-16272336IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.553274337IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.87E-11276326No hitNo description
Gene3DG3DSA:1.20.5.1701.3E-10276328No hitNo description
PfamPF001702.9E-9276328IPR004827Basic-leucine zipper domain
CDDcd147034.34E-22277328No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MNDAHAHAAM MQQALGMSLP MAQFLPDQGS AKLTRPPGLP PTPPQAFAAL QRGDVCMEAV  60
VDPAAQQQGP RKAHRRSRSD VPFGYFPPAS GGGGHGHHQL PPPKVEAGWG GGHLHGGGGG  120
DEDLFNAYLN LEGLDGLNSS DDRHDDGDSR GSSMKTNGAD SSENESDECA ADSRAGIRLW  180
SEAAVAAAAD RREGLKRTAA GEPAAAPLPR HARSLSMDSL IGKLNFSAGA TGAASGVIPG  240
PNMFKLEFGS GEFTPGEMKK IMADDKLAEM ALADPKRVKR VLANRQSAAR SKERKMRYIA  300
ELEQKVQILQ TEATTLSAQL TLLQRDSAGI ATQNNELKFR LQAMEQQAQL RDALNEALTG  360
ELQRLKVATA ELGDSCSSNN LAQQIQISVQ EQMFQLHQHQ QQQQQQATPI PFYQLQQAQQ  420
NGAGMKHESK E*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9715090.0EU971509.1 Zea mays clone 366380 DNA binding protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002468594.10.0hypothetical protein SORBIDRAFT_01g048710
TrEMBLC5X0030.0C5X003_SORBI; Putative uncharacterized protein Sb01g048710
STRINGSb01g048710.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.33e-66bZIP family protein